Lineage for d1q9tb3 (1q9t B:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739974Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2739987Domain d1q9tb3: 1q9t B:1-111 [302922]
    Other proteins in same PDB: d1q9ta3, d1q9ta4, d1q9tb4
    automated match to d3t77b1
    complexed with mg, zn

Details for d1q9tb3

PDB Entry: 1q9t (more details), 1.74 Å

PDB Description: S25-2- a(2-4)Kdo disaccharide complex
PDB Compounds: (B:) S25-2 Fab (IgG1k) heavy chain

SCOPe Domain Sequences for d1q9tb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9tb3 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
sa

SCOPe Domain Coordinates for d1q9tb3:

Click to download the PDB-style file with coordinates for d1q9tb3.
(The format of our PDB-style files is described here.)

Timeline for d1q9tb3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q9tb4