Lineage for d1q1db1 (1q1d B:8-245)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973765Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2973792Protein DNA topoisomerase II [103226] (1 species)
  7. 2973793Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103227] (3 PDB entries)
  8. 2973797Domain d1q1db1: 1q1d B:8-245 [302904]
    Other proteins in same PDB: d1q1da2, d1q1db2
    automated match to d1pvga2
    complexed with anp, cdx, mg

Details for d1q1db1

PDB Entry: 1q1d (more details), 1.9 Å

PDB Description: Crystal Structure of the ATPase region of Saccharomyces Cerevisiae topoisomerase II bound to ICRF-187 (dexrazoxane)
PDB Compounds: (B:) DNA topoisomerase II

SCOPe Domain Sequences for d1q1db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1db1 d.122.1.2 (B:8-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
asdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifdei
lvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllts
snydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkits
ykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkir

SCOPe Domain Coordinates for d1q1db1:

Click to download the PDB-style file with coordinates for d1q1db1.
(The format of our PDB-style files is described here.)

Timeline for d1q1db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q1db2