Lineage for d1q1da2 (1q1d A:246-410)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2500239Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2500240Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2500433Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 protein domains)
  6. 2500458Protein DNA topoisomerase II [102751] (1 species)
  7. 2500459Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102752] (3 PDB entries)
  8. 2500462Domain d1q1da2: 1q1d A:246-410 [302903]
    Other proteins in same PDB: d1q1da1, d1q1db1
    automated match to d1qzra1
    complexed with anp, cdx, mg

Details for d1q1da2

PDB Entry: 1q1d (more details), 1.9 Å

PDB Description: Crystal Structure of the ATPase region of Saccharomyces Cerevisiae topoisomerase II bound to ICRF-187 (dexrazoxane)
PDB Compounds: (A:) DNA topoisomerase II

SCOPe Domain Sequences for d1q1da2:

Sequence, based on SEQRES records: (download)

>d1q1da2 d.14.1.3 (A:246-410) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nfknyvelylkslekkrqldngedgaaksdiptilyerinnrwevafavsdisfqqisfv
nsiattmggthvnyitdqivkkiseilkkkkkksvksfqiknnmfifinclienpaftsq
tkeqlttrvkdfgsrceipleyinkimktdlatrmfeiadaneen

Sequence, based on observed residues (ATOM records): (download)

>d1q1da2 d.14.1.3 (A:246-410) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nfknyvelylksliptilyerinnrwevafavsdisfqqisfvnsiattmggthvnyitd
qivkkiseilkkvksfqiknnmfifinclienpaftsqtkeqlttrvkdfgsrceipley
inkimktdlatrmfeiadaneen

SCOPe Domain Coordinates for d1q1da2:

Click to download the PDB-style file with coordinates for d1q1da2.
(The format of our PDB-style files is described here.)

Timeline for d1q1da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q1da1