Lineage for d1pmzb_ (1pmz B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324735Family a.39.1.10: Polcalcin [89048] (3 proteins)
    calcium-binding pollen allergen; two EF-hands per subunit
  6. 2324739Protein Polcalcin Che a 3 [109816] (1 species)
  7. 2324740Species Pigweed (Chenopodium album) [TaxId:3559] [109817] (2 PDB entries)
    Uniprot Q84V36
  8. 2324746Domain d1pmzb_: 1pmz B: [302896]
    automated match to d2opoc_
    complexed with ca, so4

Details for d1pmzb_

PDB Entry: 1pmz (more details), 1.9 Å

PDB Description: Structure of the calcium-binding pollen allergen Che a 3
PDB Compounds: (B:) pollen allergen Che a 3

SCOPe Domain Sequences for d1pmzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmzb_ a.39.1.10 (B:) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}
dtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfis
fdeftdfaranrglvkdvskif

SCOPe Domain Coordinates for d1pmzb_:

Click to download the PDB-style file with coordinates for d1pmzb_.
(The format of our PDB-style files is described here.)

Timeline for d1pmzb_: