Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.10: Polcalcin [89048] (3 proteins) calcium-binding pollen allergen; two EF-hands per subunit |
Protein Polcalcin Che a 3 [109816] (1 species) |
Species Pigweed (Chenopodium album) [TaxId:3559] [109817] (2 PDB entries) Uniprot Q84V36 |
Domain d1pmzb_: 1pmz B: [302896] automated match to d2opoc_ complexed with ca, so4 |
PDB Entry: 1pmz (more details), 1.9 Å
SCOPe Domain Sequences for d1pmzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmzb_ a.39.1.10 (B:) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} dtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfis fdeftdfaranrglvkdvskif
Timeline for d1pmzb_: