Lineage for d1pf0a_ (1pf0 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426017Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2426023Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2426137Protein Putative ion channel CnbD [110321] (1 species)
  7. 2426138Species Mesorhizobium loti [TaxId:381] [110322] (3 PDB entries)
    Uniprot Q98GN8 218-350 # mll3241
  8. 2426139Domain d1pf0a_: 1pf0 A: [302893]
    automated match to d1vp6a_
    complexed with amp, br

Details for d1pf0a_

PDB Entry: 1pf0 (more details), 1.7 Å

PDB Description: M. loti Ion Channel Cylic Nucleotide Binding Domain
PDB Compounds: (A:) cnbd

SCOPe Domain Sequences for d1pf0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf0a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
aeifrktalerrg

SCOPe Domain Coordinates for d1pf0a_:

Click to download the PDB-style file with coordinates for d1pf0a_.
(The format of our PDB-style files is described here.)

Timeline for d1pf0a_: