| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein Hypothetical transcriptional regulator YcdC [88973] (1 species) |
| Species Escherichia coli [TaxId:562] [88974] (4 PDB entries) |
| Domain d1pb6d3: 1pb6 D:14-85 [302890] Other proteins in same PDB: d1pb6a4, d1pb6b4, d1pb6c4, d1pb6d4 automated match to d3loca1 |
PDB Entry: 1pb6 (more details), 2.5 Å
SCOPe Domain Sequences for d1pb6d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pb6d3 a.4.1.9 (D:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
diwlaplkafre
Timeline for d1pb6d3: