SCOPe 2.08: Domain d1pb6b4: 1pb6 B:86-211

Lineage for d1pb6b4 (1pb6 B:86-211)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)

7. Species Escherichia coli [TaxId:562] [89137] (4 PDB entries)

8. Domain d1pb6b4: 1pb6 B:86-211 [302887]
   Other proteins in same PDB: d1pb6a3, d1pb6b3, d1pb6c3, d1pb6d3
   automated match to d3loca2

Details for d1pb6b4

PDB Entry: 1pb6, 2.5 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator ycdC

PDB Compounds: (B:) Hypothetical transcriptional regulator ycdC

SCOPe Domain Sequences for d1pb6b4:

Sequence; same for both SEQRES and ATOM records:

>d1pb6b4 a.121.1.1 (B:86-211) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

Timeline for d1pb6b4:

• d1pb6b4 first appeared in SCOPe 2.06
  
• d1pb6b4 appears in SCOPe 2.07