| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
| Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam PF02567 |
| Protein Hypothetical protein YddE [89864] (1 species) |
| Species Escherichia coli [TaxId:562] [89865] (4 PDB entries) Uniprot P37757 structural genomics; NESG target ET25 |
| Domain d1p9va4: 1p9v A:142-309 [302881] Other proteins in same PDB: d1p9va5, d1p9va6 automated match to d1sdja2 complexed with so4 |
PDB Entry: 1p9v (more details), 2.3 Å
SCOPe Domain Sequences for d1p9va4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9va4 d.21.1.2 (A:142-309) Hypothetical protein YddE {Escherichia coli [TaxId: 562]}
egetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspdlnaltaisk
kigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhnvlphdgnvl
rvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaiel
Timeline for d1p9va4: