![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species) the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51897] (2 PDB entries) |
![]() | Domain d1ee9a1: 1ee9 A:149-319 [30288] Other proteins in same PDB: d1ee9a2 complexed with nad |
PDB Entry: 1ee9 (more details), 3 Å
SCOP Domain Sequences for d1ee9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ee9a1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pctplaivkileflkiynnllpegnrlygkkcivinrseivgrplaallandgatvysvd vnniqkftrgeslklnkhhvedlgeysedllkkcsldsdvvitgvpsenykfpteyikeg avcinfactknfsddvkekaslyvpmtgkvtiamllrnmlrlvrnvelske
Timeline for d1ee9a1: