SCOP 1.71: Domain d1ee9a1: 1ee9 A:149-319

Lineage for d1ee9a1 (1ee9 A:149-319)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species)
   the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51897] (2 PDB entries)

8. Domain d1ee9a1: 1ee9 A:149-319 [30288]
   Other proteins in same PDB: d1ee9a2
   complexed with nad

Details for d1ee9a1

PDB Entry: 1ee9, 3 Å

PDB Description: crystal structure of the nad-dependent 5,10-methylenetetrahydrofolate dehydrogenase from saccharomyces cerevisiae complexed with nad

SCOP Domain Sequences for d1ee9a1:

Sequence; same for both SEQRES and ATOM records:

>d1ee9a1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae)}
pctplaivkileflkiynnllpegnrlygkkcivinrseivgrplaallandgatvysvd
vnniqkftrgeslklnkhhvedlgeysedllkkcsldsdvvitgvpsenykfpteyikeg
avcinfactknfsddvkekaslyvpmtgkvtiamllrnmlrlvrnvelske

Timeline for d1ee9a1:

• d1ee9a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ee9a1 appears in SCOP 1.69
  
• d1ee9a1 appears in SCOP 1.73
  
• d1ee9a1 appears in the current release, SCOPe 2.08