Lineage for d1ee9a1 (1ee9 A:149-319)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118878Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 118947Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species)
  7. 118948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51897] (2 PDB entries)
  8. 118950Domain d1ee9a1: 1ee9 A:149-319 [30288]
    Other proteins in same PDB: d1ee9a2

Details for d1ee9a1

PDB Entry: 1ee9 (more details), 3 Å

PDB Description: crystal structure of the nad-dependent 5,10-methylenetetrahydrofolate dehydrogenase from saccharomyces cerevisiae complexed with nad

SCOP Domain Sequences for d1ee9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee9a1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae)}
pctplaivkileflkiynnllpegnrlygkkcivinrseivgrplaallandgatvysvd
vnniqkftrgeslklnkhhvedlgeysedllkkcsldsdvvitgvpsenykfpteyikeg
avcinfactknfsddvkekaslyvpmtgkvtiamllrnmlrlvrnvelske

SCOP Domain Coordinates for d1ee9a1:

Click to download the PDB-style file with coordinates for d1ee9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ee9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ee9a2