Lineage for d1p6zr_ (1p6z R:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695732Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2695733Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 2695734Protein Trp repressor, TrpR [48297] (1 species)
  7. 2695735Species Escherichia coli [TaxId:562] [48298] (19 PDB entries)
  8. 2695748Domain d1p6zr_: 1p6z R: [302879]
    automated match to d1wrpr_

Details for d1p6zr_

PDB Entry: 1p6z (more details), 1.67 Å

PDB Description: E. Coli Trp Apo-Repressor, Monoclinic Crystal Form
PDB Compounds: (R:) trp operon repressor

SCOPe Domain Sequences for d1p6zr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6zr_ a.4.12.1 (R:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknelgagiatitrgsnslkaapvelrqwleevll

SCOPe Domain Coordinates for d1p6zr_:

Click to download the PDB-style file with coordinates for d1p6zr_.
(The format of our PDB-style files is described here.)

Timeline for d1p6zr_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p6zn_