Lineage for d1p41c1 (1p41 C:1-74)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694082Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein)
    automatically mapped to Pfam PF09182
  6. 2694083Protein N-terminal domain of Bacillus PurR [101022] (1 species)
  7. 2694084Species Bacillus subtilis [TaxId:1423] [101023] (3 PDB entries)
  8. 2694087Domain d1p41c1: 1p41 C:1-74 [302873]
    Other proteins in same PDB: d1p41a2, d1p41b2, d1p41c2, d1p41d2
    automated match to d1o57b1
    complexed with 1pe, 2pe, epe, p6g, pg4, so4

Details for d1p41c1

PDB Entry: 1p41 (more details), 2.2 Å

PDB Description: Crystal Structure of the Purine operon repressor of Bacillus Subtilis
PDB Compounds: (C:) pur operon repressor

SCOPe Domain Sequences for d1p41c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p41c1 a.4.5.40 (C:1-74) N-terminal domain of Bacillus PurR {Bacillus subtilis [TaxId: 1423]}
mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
tvpgaaggvkyipk

SCOPe Domain Coordinates for d1p41c1:

Click to download the PDB-style file with coordinates for d1p41c1.
(The format of our PDB-style files is described here.)

Timeline for d1p41c1: