Lineage for d1edza1 (1edz A:149-319)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species)
    the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51897] (2 PDB entries)
  8. Domain d1edza1: 1edz A:149-319 [30287]
    Other proteins in same PDB: d1edza2
    has additional insertions and/or extensions that are not grouped together
    missing some secondary structures that made up less than one-third of the common domain

Details for d1edza1

PDB Entry: 1edz (more details), 2.8 Å

PDB Description: structure of the nad-dependent 5,10-methylenetetrahydrofolate dehydrogenase from saccharomyces cerevisiae
PDB Compounds: (A:) 5,10-methylenetetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d1edza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pctplaivkileflkiynnllpegnrlygkkcivinrseivgrplaallandgatvysvd
vnniqkftrgeslklnkhhvedlgeysedllkkcsldsdvvitgvpsenykfpteyikeg
avcinfactknfsddvkekaslyvpmtgkvtiamllrnmlrlvrnvelske

SCOPe Domain Coordinates for d1edza1 are not available.

Timeline for d1edza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1edza2