SCOPe 2.08: Domain d1ojua4: 1oju A:164-331

Lineage for d1ojua4 (1oju A:164-331)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (20 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [111253] (4 PDB entries)
   Uniprot O08349

8. Domain d1ojua4: 1oju A:164-331 [302862]
   Other proteins in same PDB: d1ojua3
   automated match to d2x0ia2
   complexed with ena, nca, so4

Details for d1ojua4

PDB Entry: 1oju, 2.79 Å

PDB Description: 2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad.

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1ojua4:

Sequence; same for both SEQRES and ATOM records:

>d1ojua4 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
gnqldsqrlkerlynagarnirrawiigehgdsmfvaksladfdgevdweavendvrfva
aevikrkgatifgpavaiyrmvkavvedtgeiiptsmilqgeygienvavgvpaklgkng
aevadiklsdeeieklrnsakilrerleelgy

Timeline for d1ojua4:

• d1ojua4 first appeared in SCOPe 2.06
  
• d1ojua4 appears in SCOPe 2.07