| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Malate dehydrogenase [51849] (13 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [110427] (4 PDB entries) Uniprot O08349 |
| Domain d1ojua3: 1oju A:22-163 [302861] Other proteins in same PDB: d1ojua4 automated match to d2x0ia1 complexed with ena, nca, so4 |
PDB Entry: 1oju (more details), 2.79 Å
SCOPe Domain Sequences for d1ojua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ojua3 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
mdvmtyimwkesgkprnevfgm
Timeline for d1ojua3: