SCOPe 2.08: Domain d1ojua3: 1oju A:22-163

Lineage for d1ojua3 (1oju A:22-163)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [110427] (4 PDB entries)
   Uniprot O08349

8. Domain d1ojua3: 1oju A:22-163 [302861]
   Other proteins in same PDB: d1ojua4
   automated match to d2x0ia1
   complexed with ena, nca, so4

Details for d1ojua3

PDB Entry: 1oju, 2.79 Å

PDB Description: 2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad.

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1ojua3:

Sequence; same for both SEQRES and ATOM records:

>d1ojua3 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
mdvmtyimwkesgkprnevfgm

Timeline for d1ojua3:

• d1ojua3 first appeared in SCOPe 2.06
  
• d1ojua3 appears in SCOPe 2.07