SCOP 1.69: Domain d1b0aa1: 1b0a A:123-288

Lineage for d1b0aa1 (1b0a A:123-288)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species)
   the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated

7. Species Escherichia coli [TaxId:562] [51896] (1 PDB entry)

8. Domain d1b0aa1: 1b0a A:123-288 [30286]
   Other proteins in same PDB: d1b0aa2

Details for d1b0aa1

PDB Entry: 1b0a, 2.56 Å

PDB Description: 5,10, methylene-tetrahydropholate dehydrogenase/cyclohydrolase from e coli.

SCOP Domain Sequences for d1b0aa1:

Sequence; same for both SEQRES and ATOM records:

>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli}
fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla
gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvvg
dvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdpqde

Timeline for d1b0aa1:

• d1b0aa1 first appeared (with stable ids) in SCOP 1.55
  
• d1b0aa1 appears in SCOP 1.67
  
• d1b0aa1 appears in SCOP 1.71
  
• d1b0aa1 appears in the current release, SCOPe 2.08