Lineage for d1ojsa3 (1ojs A:22-163)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2453110Protein Malate dehydrogenase [51849] (13 species)
  7. 2453115Species Archaeoglobus fulgidus [TaxId:2234] [110427] (4 PDB entries)
    Uniprot O08349
  8. 2453117Domain d1ojsa3: 1ojs A:22-163 [302859]
    Other proteins in same PDB: d1ojsa4
    automated match to d2x0ia1
    complexed with na, nad, so4

Details for d1ojsa3

PDB Entry: 1ojs (more details), 2.9 Å

PDB Description: 2.9 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with nadh.
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1ojsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojsa3 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
mdvmtyimwkesgkprnevfgm

SCOPe Domain Coordinates for d1ojsa3:

Click to download the PDB-style file with coordinates for d1ojsa3.
(The format of our PDB-style files is described here.)

Timeline for d1ojsa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojsa4