SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ogra4 (1ogr A:2-182)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037498Protein Spore coat protein A, CotA [89219] (2 species)
  7. 2037499Species Bacillus subtilis [TaxId:1423] [89220] (13 PDB entries)
    Uniprot P07788
  8. 2037533Domain d1ogra4: 1ogr A:2-182 [302852]
    automated match to d1gska1
    complexed with cu

Details for d1ogra4

PDB Entry: 1ogr (more details), 2.65 Å

PDB Description: crystal structure of bacillus subtilis cota after 6h soaking with abts
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d1ogra4:

Sequence, based on SEQRES records: (download)

>d1ogra4 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records): (download)

>d1ogra4 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihepevktvvhlhggvtpddsdgypeawfskdfe
qtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

SCOPe Domain Coordinates for d1ogra4:

Click to download the PDB-style file with coordinates for d1ogra4.
(The format of our PDB-style files is described here.)

Timeline for d1ogra4:

  • d1ogra4 is new in SCOPe 2.06-stable