Lineage for d1dibb1 (1dib B:1127-1296)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453552Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2453697Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species)
    the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated
  7. 2453703Species Human (Homo sapiens) [TaxId:9606] [51895] (7 PDB entries)
  8. 2453711Domain d1dibb1: 1dib B:1127-1296 [30285]
    Other proteins in same PDB: d1diba2, d1dibb2
    complexed with l34, nap

Details for d1dibb1

PDB Entry: 1dib (more details), 2.7 Å

PDB Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly345899
PDB Compounds: (B:) methylenetetrahydrofolate dehydrogenase/cyclohydrolase

SCOPe Domain Sequences for d1dibb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dibb1 c.2.1.7 (B:1127-1296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]}
ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll
wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpddkk
pngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle

SCOPe Domain Coordinates for d1dibb1:

Click to download the PDB-style file with coordinates for d1dibb1.
(The format of our PDB-style files is described here.)

Timeline for d1dibb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dibb2