SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1og9c3 (1og9 C:1-253)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2146374Family c.95.1.1: Thiolase-related [53902] (10 protein domains)
  6. 2146395Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 2146396Species Escherichia coli [TaxId:562] [53908] (19 PDB entries)
    Uniprot P14926
  8. 2146489Domain d1og9c3: 1og9 C:1-253 [302848]
    automated match to d1fj4a1
    complexed with hyd, nh4, oca

Details for d1og9c3

PDB Entry: 1og9 (more details), 2.4 Å

PDB Description: e. coli beta-ketoacyl [acyl carrier protein] synthase i in complex with octanoic acid, 120k
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d1og9c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1og9c3 c.95.1.1 (C:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d1og9c3:

Click to download the PDB-style file with coordinates for d1og9c3.
(The format of our PDB-style files is described here.)

Timeline for d1og9c3:

  • d1og9c3 is new in SCOPe 2.06-stable