Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species) the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated |
Species Human (Homo sapiens) [TaxId:9606] [51895] (4 PDB entries) |
Domain d1digb1: 1dig B:1127-1296 [30283] Other proteins in same PDB: d1diga2, d1digb2 complexed with act, l37, nap |
PDB Entry: 1dig (more details), 2.2 Å
SCOP Domain Sequences for d1digb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1digb1 c.2.1.7 (B:1127-1296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens)} ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpddkk pngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle
Timeline for d1digb1: