Lineage for d1digb1 (1dig B:1127-1296)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575952Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 576082Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species)
    the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated
  7. 576088Species Human (Homo sapiens) [TaxId:9606] [51895] (4 PDB entries)
  8. 576094Domain d1digb1: 1dig B:1127-1296 [30283]
    Other proteins in same PDB: d1diga2, d1digb2
    complexed with act, l37, nap

Details for d1digb1

PDB Entry: 1dig (more details), 2.2 Å

PDB Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly374571

SCOP Domain Sequences for d1digb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1digb1 c.2.1.7 (B:1127-1296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens)}
ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll
wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpddkk
pngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle

SCOP Domain Coordinates for d1digb1:

Click to download the PDB-style file with coordinates for d1digb1.
(The format of our PDB-style files is described here.)

Timeline for d1digb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1digb2