Lineage for d1digb1 (1dig B:1127-1296)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66936Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 67005Protein Methylenetetrahydrofolate dehydrogenase/cyclohydrolase [51894] (3 species)
  7. 67011Species Human (Homo sapiens) [TaxId:9606] [51895] (4 PDB entries)
  8. 67017Domain d1digb1: 1dig B:1127-1296 [30283]
    Other proteins in same PDB: d1diga2, d1digb2

Details for d1digb1

PDB Entry: 1dig (more details), 2.2 Å

PDB Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly374571

SCOP Domain Sequences for d1digb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1digb1 c.2.1.7 (B:1127-1296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens)}
ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll
wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpddkk
pngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle

SCOP Domain Coordinates for d1digb1:

Click to download the PDB-style file with coordinates for d1digb1.
(The format of our PDB-style files is described here.)

Timeline for d1digb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1digb2