SCOPe 2.07: Domain d1oerb4: 1oer B:254-406

Lineage for d1oerb4 (1oer B:254-406)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (68 species)
   not a true protein

7. Species Escherichia coli [311165] (2 PDB entries)

8. Domain d1oerb4: 1oer B:254-406 [302828]
   Other proteins in same PDB: d1oera3, d1oerb3, d1oerc3, d1oerd3
   automated match to d2vbac2
   complexed with dao, nh4; mutant

Details for d1oerb4

PDB Entry: 1oer, 2 Å

PDB Description: kas i lys328ala mutant in complex with fatty acid

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d1oerb4:

Sequence; same for both SEQRES and ATOM records:

>d1oerb4 c.95.1.0 (B:254-406) automated matches {Escherichia coli}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

Timeline for d1oerb4:

• d1oerb4 first appeared in SCOPe 2.06