Lineage for d1oeqc4 (1oeq C:254-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917634Species Escherichia coli [311165] (2 PDB entries)
  8. 2917637Domain d1oeqc4: 1oeq C:254-406 [302822]
    Other proteins in same PDB: d1oeqa3, d1oeqb3, d1oeqc3, d1oeqd3
    automated match to d2vbac2
    complexed with hyd, nh4; mutant

Details for d1oeqc4

PDB Entry: 1oeq (more details), 1.7 Å

PDB Description: structure of escherichia coli beta-ketoacyl [acyl carrier protein] synthase i lys328ala mutant
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d1oeqc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oeqc4 c.95.1.0 (C:254-406) automated matches {Escherichia coli}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisataamtghslgakgvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOPe Domain Coordinates for d1oeqc4:

Click to download the PDB-style file with coordinates for d1oeqc4.
(The format of our PDB-style files is described here.)

Timeline for d1oeqc4: