SCOPe 2.07: Domain d1oama1: 1oam A:1-297

Lineage for d1oama1 (1oam A:1-297)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)

6. Protein Envelope glycoprotein [56985] (2 species)

7. Species Dengue virus type 2 [TaxId:11060] [90131] (8 PDB entries)
   Uniprot P12823 281-675

8. Domain d1oama1: 1oam A:1-297 [302813]
   Other proteins in same PDB: d1oama2, d1oamb2
   automated match to d1ok8a2
   complexed with bgl, nag

Details for d1oama1

PDB Entry: 1oam, 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside

PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d1oama1:

Sequence; same for both SEQRES and ATOM records:

>d1oama1 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Timeline for d1oama1:

• d1oama1 first appeared in SCOPe 2.06
  
• d1oama1 appears in the current release, SCOPe 2.08