Lineage for d1oama1 (1oam A:1-297)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576583Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2576584Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2576585Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 protein domains)
  6. 2576586Protein Envelope glycoprotein [56985] (2 species)
  7. 2576587Species Dengue virus type 2 [TaxId:11060] [90131] (8 PDB entries)
    Uniprot P12823 281-675
  8. 2576589Domain d1oama1: 1oam A:1-297 [302813]
    Other proteins in same PDB: d1oama2, d1oamb2
    automated match to d1ok8a2
    complexed with bgl, nag

Details for d1oama1

PDB Entry: 1oam (more details), 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d1oama1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oama1 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOPe Domain Coordinates for d1oama1:

Click to download the PDB-style file with coordinates for d1oama1.
(The format of our PDB-style files is described here.)

Timeline for d1oama1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oama2