Lineage for d1o5yb1 (1o5y B:1-141)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614857Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
    duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet
  4. 2614858Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family) (S)
    automatically mapped to Pfam PF02577
  5. 2614859Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)
  6. 2614860Protein Hypothetical protein TM0160 [103258] (1 species)
  7. 2614861Species Thermotoga maritima [TaxId:2336] [103259] (3 PDB entries)
  8. 2614865Domain d1o5yb1: 1o5y B:1-141 [302809]
    Other proteins in same PDB: d1o5ya2, d1o5yb2
    automated match to d1vjla_
    complexed with cl, unl

Details for d1o5yb1

PDB Entry: 1o5y (more details), 1.9 Å

PDB Description: Crystal structure of hypothetical protein (TM0160) from Thermotoga maritima at 1.90 A resolution
PDB Compounds: (B:) conserved hypothetical protein TM0160

SCOPe Domain Sequences for d1o5yb1:

Sequence, based on SEQRES records: (download)

>d1o5yb1 d.257.1.1 (B:1-141) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiila
vktgapifvsdnlvekhsiel

Sequence, based on observed residues (ATOM records): (download)

>d1o5yb1 d.257.1.1 (B:1-141) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltyeeaalididsrpsdaiilavktga
pifvsdnlvekhsiel

SCOPe Domain Coordinates for d1o5yb1:

Click to download the PDB-style file with coordinates for d1o5yb1.
(The format of our PDB-style files is described here.)

Timeline for d1o5yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o5yb2