SCOPe 2.08: Domain d1o5ya1: 1o5y A:1-150

Lineage for d1o5ya1 (1o5y A:1-150)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.257: Hypothetical protein TM0160 [103255] (1 superfamily)
   duplication: consists of two beta(3)-alpha(2) structural repeats; single barrel-like beta-sheet

4. Superfamily d.257.1: Hypothetical protein TM0160 [103256] (1 family)
   automatically mapped to Pfam PF02577

5. Family d.257.1.1: Hypothetical protein TM0160 [103257] (1 protein)

6. Protein Hypothetical protein TM0160 [103258] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [103259] (3 PDB entries)

8. Domain d1o5ya1: 1o5y A:1-150 [302807]
   Other proteins in same PDB: d1o5ya2, d1o5yb2
   automated match to d1vjla_
   complexed with cl, unl

Details for d1o5ya1

PDB Entry: 1o5y, 1.9 Å

PDB Description: Crystal structure of hypothetical protein (TM0160) from Thermotoga maritima at 1.90 A resolution

PDB Compounds: (A:) conserved hypothetical protein TM0160

SCOPe Domain Sequences for d1o5ya1:

Sequence, based on SEQRES records:

>d1o5ya1 d.257.1.1 (A:1-150) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltytdeedeeaalididsrpsdaiila
vktgapifvsdnlvekhsielevnetqdee

Sequence, based on observed residues (ATOM records):

>d1o5ya1 d.257.1.1 (A:1-150) Hypothetical protein TM0160 {Thermotoga maritima [TaxId: 2336]}
mrkawvktlaldrvsntpvvilgiegtnrvlpiwigaceghalalamekmefprplthdl
llsvleslearvdkviihslkdntfyatlvirdltaalididsrpsdaiilavktgapif
vsdnlvekhsielevnetqdee

Timeline for d1o5ya1:

• d1o5ya1 first appeared in SCOPe 2.06
  
• d1o5ya1 appears in SCOPe 2.07