SCOPe 2.08: Domain d1o5nb_: 1o5n B:

Lineage for d1o5nb_ (1o5n B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.10: TM1459-like [101976] (3 proteins)

6. Protein Hypothetical protein TM1459 [101977] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101978] (2 PDB entries)

8. Domain d1o5nb_: 1o5n B: [302806]
   automated match to d1vj2a_
   complexed with mn

Details for d1o5nb_

PDB Entry: 1o5n, 1.65 Å

PDB Description: Crystal structure of hypothetical protein (TM1459) from Thermotoga maritima at 1.65 A resolution

PDB Compounds: (B:) conserved hypothetical protein TM1459

SCOPe Domain Sequences for d1o5nb_:

Sequence; same for both SEQRES and ATOM records:

>d1o5nb_ b.82.1.10 (B:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

Timeline for d1o5nb_:

• d1o5nb_ first appeared in SCOPe 2.06
  
• d1o5nb_ appears in SCOPe 2.07