Lineage for d1o5nb_ (1o5n B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814828Family b.82.1.10: TM1459-like [101976] (3 proteins)
  6. 2814865Protein Hypothetical protein TM1459 [101977] (1 species)
  7. 2814866Species Thermotoga maritima [TaxId:2336] [101978] (2 PDB entries)
  8. 2814868Domain d1o5nb_: 1o5n B: [302806]
    automated match to d1vj2a_
    complexed with mn

Details for d1o5nb_

PDB Entry: 1o5n (more details), 1.65 Å

PDB Description: Crystal structure of hypothetical protein (TM1459) from Thermotoga maritima at 1.65 A resolution
PDB Compounds: (B:) conserved hypothetical protein TM1459

SCOPe Domain Sequences for d1o5nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5nb_ b.82.1.10 (B:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

SCOPe Domain Coordinates for d1o5nb_:

Click to download the PDB-style file with coordinates for d1o5nb_.
(The format of our PDB-style files is described here.)

Timeline for d1o5nb_: