Lineage for d1o0ua_ (1o0u A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150479Fold c.118: GckA/TtuD-like [82543] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456, Rossmann-like topology
    Domain 2 has mixed sheet of 6 strands, order 126345; strands 5 and 6 are antiparallel to the rest; some similarity to CbiF Domain 2
  4. 2150480Superfamily c.118.1: GckA/TtuD-like [82544] (2 families) (S)
  5. 2150481Family c.118.1.1: GckA/TtuD-like [82545] (1 protein)
  6. 2150482Protein Putative glycerate kinase (hypothetical protein TM1585) [82546] (1 species)
  7. 2150483Species Thermotoga maritima [TaxId:2336] [82547] (2 PDB entries)
  8. 2150486Domain d1o0ua_: 1o0u A: [302797]
    automated match to d2b8na_

Details for d1o0ua_

PDB Entry: 1o0u (more details), 2.95 Å

PDB Description: Crystal structure of Glycerate kinase (TM1585) from Thermotoga maritima at 2.95 A resolution
PDB Compounds: (A:) Glycerate kinase

SCOPe Domain Sequences for d1o0ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0ua_ c.118.1.1 (A:) Putative glycerate kinase (hypothetical protein TM1585) {Thermotoga maritima [TaxId: 2336]}
peslkklaieivkksieavfpdravketlpklnldrvilvavgkaawrmakaayevlgkk
irkgvvvtkyghsegpiddfeiyeaghpvpdentikttrrvlelvdqlnendtvlfllsg
ggsslfelplegvsleeiqkltsallksgasieeintvrkhlsqvkggrfaervfpakvv
alvlsdvlgdrldviasgpawpdsstsedalkvlekygietsesvkrailqetpkhlsnv
eihlignvqkvcdeakslakekgfnaeiittsldceareagrfiasimkevkfkdrplkk
paalifggetvvhvkgngiggrnqelalsaaialegiegvilcsagtdgtdgptdaaggi
vdgstaktlkamgedpyqylknndsynalkksgallitgptgtnvndliigliv

SCOPe Domain Coordinates for d1o0ua_:

Click to download the PDB-style file with coordinates for d1o0ua_.
(The format of our PDB-style files is described here.)

Timeline for d1o0ua_:

  • d1o0ua_ is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d1o0ub_