SCOPe 2.07: Domain d1o0ib_: 1o0i B:

Lineage for d1o0ib_ (1o0i B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Hypothetical protein HI1161 [89905] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89906] (3 PDB entries)

8. Domain d1o0ib_: 1o0i B: [302796]
   automated match to d1sc0a_

Details for d1o0ib_

PDB Entry: 1o0i, 1.7 Å

PDB Description: x-ray structure of yb61_haein northeast structural genomics consortium target ir63.

PDB Compounds: (B:) Hypothetical protein HI1161

SCOPe Domain Sequences for d1o0ib_:

Sequence; same for both SEQRES and ATOM records:

>d1o0ib_ d.38.1.5 (B:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval
aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte
enklccvsrltlsvinl

Timeline for d1o0ib_:

• d1o0ib_ first appeared in SCOPe 2.06
  
• d1o0ib_ appears in the current release, SCOPe 2.08