Lineage for d1o0ib_ (1o0i B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943866Protein Hypothetical protein HI1161 [89905] (1 species)
  7. 2943867Species Haemophilus influenzae [TaxId:727] [89906] (3 PDB entries)
  8. 2943869Domain d1o0ib_: 1o0i B: [302796]
    automated match to d1sc0a_

Details for d1o0ib_

PDB Entry: 1o0i (more details), 1.7 Å

PDB Description: x-ray structure of yb61_haein northeast structural genomics consortium target ir63.
PDB Compounds: (B:) Hypothetical protein HI1161

SCOPe Domain Sequences for d1o0ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0ib_ d.38.1.5 (B:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval
aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte
enklccvsrltlsvinl

SCOPe Domain Coordinates for d1o0ib_:

Click to download the PDB-style file with coordinates for d1o0ib_.
(The format of our PDB-style files is described here.)

Timeline for d1o0ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o0ia_