Lineage for d1nrhx4 (1nrh X:170-445)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557344Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 2557377Protein Maltose-6'-phosphate glucosidase GlvA [103329] (1 species)
  7. 2557378Species Bacillus subtilis [TaxId:1423] [103330] (2 PDB entries)
    Uniprot P54716
  8. 2557380Domain d1nrhx4: 1nrh X:170-445 [302781]
    Other proteins in same PDB: d1nrhx3
    automated match to d1u8xx2
    complexed with g6p, mn, nad

Details for d1nrhx4

PDB Entry: 1nrh (more details), 2.05 Å

PDB Description: crystal structure of glva gene product from bacillus subtilis, a metal-requiring, nad-dependent 6-phospho-alpha-glucosidase
PDB Compounds: (X:) Maltose-6'-phosphate glucosidase

SCOPe Domain Sequences for d1nrhx4:

Sequence, based on SEQRES records: (download)

>d1nrhx4 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]}
icdmpvgiedrmaqilglssrkemkvryyglnhfgwwtsiqdqegndlmpklkehvsqyg
yipkteaeaveaswndtfakardvqaadpdtlpntylqyylfpddmvkksnpnhtranev
megreafifsqcdmitreqssenseikiddhasyivdlaraiayntgermllivenngai
anfdptamvevpcivgsngpepitvgtipqfqkglmeqqvsvekltveawaeksfqklwq
alilsktvpnarvarliledlveankdfwpeldqsp

Sequence, based on observed residues (ATOM records): (download)

>d1nrhx4 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]}
icdmpvgiedrmaqilglssrkemkvryyglnhfgwwtsiqdqegndlmpklkehvsqyg
yipktswndtfakardvqaadpdtlpntylqyylfpddmvkksnpnhtranevmegreaf
ifsqcdmitreqssenseikiddhasyivdlaraiayntgermllivenngaianfdpta
mvevpcivgsngpepitvgtipqfqkglmeqqvsvekltveawaeksfqklwqalilskt
vpnarvarliledlveankdfwpeldqsp

SCOPe Domain Coordinates for d1nrhx4:

Click to download the PDB-style file with coordinates for d1nrhx4.
(The format of our PDB-style files is described here.)

Timeline for d1nrhx4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nrhx3