Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Maltose-6'-phosphate glucosidase GlvA [102169] (1 species) |
Species Bacillus subtilis [TaxId:1423] [102170] (2 PDB entries) Uniprot P54716 |
Domain d1nrhx3: 1nrh X:3-169 [302780] Other proteins in same PDB: d1nrhx4 automated match to d1u8xx1 complexed with g6p, mn, nad |
PDB Entry: 1nrh (more details), 2.05 Å
SCOPe Domain Sequences for d1nrhx3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nrhx3 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} kksfsiviagggstftpgivlmlldhleefpirklklydndkerqdriagacdvfireka pdiefaattdpeeaftdvdfvmahirvgkyamraldeqiplkygvvgqetcgpggiaygm rsiggvleildymekyspdawmlnysnpaaivaeatrrlrpnskiln
Timeline for d1nrhx3: