SCOPe 2.06: Domain d1nrcb_: 1nrc B:

Lineage for d1nrcb_ (1nrc B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d1nrcb_: 1nrc B: [302779]
   automated match to d1dz5a_

Details for d1nrcb_

PDB Entry: 1nrc, 2.8 Å

PDB Description: crystal structure of the rna-binding domain of the u1 small nuclear ribonucleoprotein a

PDB Compounds: (B:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d1nrcb_:

Sequence, based on SEQRES records:

>d1nrcb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmricyak

Sequence, based on observed residues (ATOM records):

>d1nrcb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslgqafvifkevssatna
lrsmqgfpfydkpmricyak

Timeline for d1nrcb_:

• d1nrcb_ is new in SCOPe 2.06-stable
  
• d1nrcb_ appears in SCOPe 2.07
  
• d1nrcb_ appears in the current release, SCOPe 2.08