Lineage for d1nrcb_ (1nrc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952350Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)
  8. 2952414Domain d1nrcb_: 1nrc B: [302779]
    automated match to d1dz5a_

Details for d1nrcb_

PDB Entry: 1nrc (more details), 2.8 Å

PDB Description: crystal structure of the rna-binding domain of the u1 small nuclear ribonucleoprotein a
PDB Compounds: (B:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d1nrcb_:

Sequence, based on SEQRES records: (download)

>d1nrcb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmricyak

Sequence, based on observed residues (ATOM records): (download)

>d1nrcb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslgqafvifkevssatna
lrsmqgfpfydkpmricyak

SCOPe Domain Coordinates for d1nrcb_:

Click to download the PDB-style file with coordinates for d1nrcb_.
(The format of our PDB-style files is described here.)

Timeline for d1nrcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nrca_