![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
![]() | Protein automated matches [190155] (3 species) not a true protein |
![]() | Species Haemophilus influenzae [TaxId:71421] [188352] (2 PDB entries) |
![]() | Domain d1nnga_: 1nng A: [302771] automated match to d1ylib_ complexed with ca, coa, gol |
PDB Entry: 1nng (more details), 1.95 Å
SCOPe Domain Sequences for d1nnga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnga_ d.38.1.1 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]} rqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvavesmnfi kpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngr srtiprennqelekalalise
Timeline for d1nnga_: