Lineage for d1bxgb1 (1bxg B:549-747)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1153510Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1153725Protein Phenylalanine dehydrogenase [51892] (1 species)
  7. 1153726Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)
  8. 1153734Domain d1bxgb1: 1bxg B:549-747 [30277]
    Other proteins in same PDB: d1bxga2, d1bxgb2
    complexed with hci, k, nad, po4

Details for d1bxgb1

PDB Entry: 1bxg (more details), 2.3 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate
PDB Compounds: (B:) phenylalanine dehydrogenase

SCOPe Domain Sequences for d1bxgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxgb1 c.2.1.7 (B:549-747) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrare

SCOPe Domain Coordinates for d1bxgb1:

Click to download the PDB-style file with coordinates for d1bxgb1.
(The format of our PDB-style files is described here.)

Timeline for d1bxgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxgb2