| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
| Protein Phenylalanine dehydrogenase [51892] (1 species) |
| Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries) |
| Domain d1bxgb1: 1bxg B:549-747 [30277] Other proteins in same PDB: d1bxga2, d1bxgb2 complexed with hci, k, nad, po4 |
PDB Entry: 1bxg (more details), 2.3 Å
SCOPe Domain Sequences for d1bxgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxgb1 c.2.1.7 (B:549-747) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrare
Timeline for d1bxgb1: