Lineage for d1bxgb1 (1bxg B:549-747)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66936Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 67036Protein Phenylalanine dehydrogenase [51892] (1 species)
  7. 67037Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)
  8. 67045Domain d1bxgb1: 1bxg B:549-747 [30277]
    Other proteins in same PDB: d1bxga2, d1bxgb2

Details for d1bxgb1

PDB Entry: 1bxg (more details), 2.3 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate

SCOP Domain Sequences for d1bxgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxgb1 c.2.1.7 (B:549-747) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrare

SCOP Domain Coordinates for d1bxgb1:

Click to download the PDB-style file with coordinates for d1bxgb1.
(The format of our PDB-style files is described here.)

Timeline for d1bxgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxgb2