SCOPe 2.08: Domain d1bxgb1: 1bxg B:549-747

Lineage for d1bxgb1 (1bxg B:549-747)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Phenylalanine dehydrogenase [51892] (1 species)

7. Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)

8. Domain d1bxgb1: 1bxg B:549-747 [30277]
   Other proteins in same PDB: d1bxga2, d1bxgb2
   complexed with hci, k, nad, po4
   has additional insertions and/or extensions that are not grouped together

Details for d1bxgb1

PDB Entry: 1bxg, 2.3 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate

PDB Compounds: (B:) phenylalanine dehydrogenase

SCOPe Domain Sequences for d1bxgb1:

Sequence; same for both SEQRES and ATOM records:

>d1bxgb1 c.2.1.7 (B:549-747) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrare

Timeline for d1bxgb1:

• d1bxgb1 first appeared (with stable ids) in SCOP 1.55
  
• d1bxgb1 appears in SCOPe 2.07