Lineage for d1ngvb_ (1ngv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149982Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 2149983Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 2149990Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 protein domains)
    the common fold is elaborated with additional (sub)domains
  6. 2150054Protein automated matches [310845] (1 species)
    not a true protein
  7. 2150055Species Homo sapiens [311164] (1 PDB entry)
  8. 2150056Domain d1ngvb_: 1ngv B: [302767]
    Other proteins in same PDB: d1ngva_, d1ngvc_
    automated match to d3dblb_
    complexed with zn

Details for d1ngvb_

PDB Entry: 1ngv (more details), 2.6 Å

PDB Description: Insights into the ubiquitin transfer cascade from the structure of the E1 for NEDD8.
PDB Compounds: (B:) uba3

SCOPe Domain Sequences for d1ngvb_:

Sequence, based on SEQRES records: (download)

>d1ngvb_ c.111.1.2 (B:) automated matches {Homo sapiens}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
qtvlfklhft

Sequence, based on observed residues (ATOM records): (download)

>d1ngvb_ c.111.1.2 (B:) automated matches {Homo sapiens}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqlqevldyltnsaslqmk
spaitatrtlylqseertrpnladvttpqtvlfklhft

SCOPe Domain Coordinates for d1ngvb_:

Click to download the PDB-style file with coordinates for d1ngvb_.
(The format of our PDB-style files is described here.)

Timeline for d1ngvb_:

  • d1ngvb_ is new in SCOPe 2.06-stable