SCOPe 2.07: Domain d1ngva_: 1ngv A:

Lineage for d1ngva_ (1ngv A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest

4. Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families)
   transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
   the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds

5. Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 proteins)
   the common fold is elaborated with additional (sub)domains

6. Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species)
   a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion

7. Species Human (Homo sapiens) [TaxId:9606] [89767] (10 PDB entries)
   Uniprot Q13564

8. Domain d1ngva_: 1ngv A: [302766]
   Other proteins in same PDB: d1ngvb_, d1ngvd_
   automated match to d1tt5a_
   complexed with zn

Details for d1ngva_

PDB Entry: 1ngv, 2.6 Å

PDB Description: Insights into the ubiquitin transfer cascade from the structure of the E1 for NEDD8.

PDB Compounds: (A:) amyloid beta precursor protein-binding protein 1

SCOPe Domain Sequences for d1ngva_:

Sequence; same for both SEQRES and ATOM records:

>d1ngva_ c.111.1.2 (A:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
dkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrd
lirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfw
ilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakll
qsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivl
ylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcry
gaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql

Timeline for d1ngva_:

• d1ngva_ first appeared in SCOPe 2.06
  
• d1ngva_ appears in the current release, SCOPe 2.08