![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
![]() | Protein Prolactin (placental lactogen) [47278] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89035] (4 PDB entries) |
![]() | Domain d1n9da_: 1n9d A: [302764] automated match to d1rw5a_ |
PDB Entry: 1n9d (more details)
SCOPe Domain Sequences for d1n9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9da_ a.26.1.1 (A:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]} lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh kidnylkllkcriihnnnc
Timeline for d1n9da_: