Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
Protein automated matches [190286] (9 species) not a true protein |
Species Rattus norvegicus [311163] (1 PDB entry) |
Domain d1n8la_: 1n8l A: [302763] automated match to d2pnga_ |
PDB Entry: 1n8l (more details)
SCOPe Domain Sequences for d1n8la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8la_ a.28.1.1 (A:) automated matches {Rattus norvegicus} gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire vrqltlrklqemsska
Timeline for d1n8la_: