Lineage for d1n8la_ (1n8l A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706187Protein automated matches [190286] (9 species)
    not a true protein
  7. 2706222Species Rattus norvegicus [311163] (1 PDB entry)
  8. 2706223Domain d1n8la_: 1n8l A: [302763]
    automated match to d2pnga_

Details for d1n8la_

PDB Entry: 1n8l (more details)

PDB Description: The NMR solution structure of the Type I rat fatty acid synthase ACP domain.
PDB Compounds: (A:) fatty acid synthase

SCOPe Domain Sequences for d1n8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8la_ a.28.1.1 (A:) automated matches {Rattus norvegicus}
gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire
vrqltlrklqemsska

SCOPe Domain Coordinates for d1n8la_:

Click to download the PDB-style file with coordinates for d1n8la_.
(The format of our PDB-style files is described here.)

Timeline for d1n8la_: