Lineage for d1n4ta1 (1n4t A:5-219)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956563Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2956564Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2956578Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins)
    automatically mapped to Pfam PF05881
  6. 2956579Protein 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103044] (1 species)
  7. 2956580Species Norway rat (Rattus norvegicus) [TaxId:10116] [103045] (2 PDB entries)
  8. 2956581Domain d1n4ta1: 1n4t A:5-219 [302760]
    Other proteins in same PDB: d1n4ta2
    automated match to d2ilxa_

Details for d1n4ta1

PDB Entry: 1n4t (more details)

PDB Description: Solution structure of the catalytic domain from rat CNP
PDB Compounds: (A:) 2',3'-cyclic nucleotide 3'-phosphodiesterase

SCOPe Domain Sequences for d1n4ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4ta1 d.61.1.3 (A:5-219) 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkekldlvsyfgk
rppgvlhcttkfcdygkatgaeeyaqqdvvrrsygkafklsisalfvtpktagaqvvlne
qelqlwpsdldkpssseslppgsrahvtlgcaadvqpvqtgldlleilqqvkggsqgeev
gelprgklyslgkgrwmlslakkmevkaiftgyyg

SCOPe Domain Coordinates for d1n4ta1:

Click to download the PDB-style file with coordinates for d1n4ta1.
(The format of our PDB-style files is described here.)

Timeline for d1n4ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n4ta2