SCOPe 2.08: Domain d1n2ub1: 1n2u B:4-182

Lineage for d1n2ub1 (1n2u B:4-182)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (2 species)

7. Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
   Uniprot Q46822

8. Domain d1n2ub1: 1n2u B:4-182 [302758]
   Other proteins in same PDB: d1n2ub2
   automated match to d1q54b_
   complexed with bhi, mg, mn

Details for d1n2ub1

PDB Entry: 1n2u, 1.93 Å

PDB Description: Structure and Mechanism of Action of Isopentenylpyrophosphate-Dimethylallylpyrophosphate Isomerase: complex with the bromohydrine of IPP

PDB Compounds: (B:) isopentenyl diphosphate delta-isomerase

SCOPe Domain Sequences for d1n2ub1:

Sequence; same for both SEQRES and ATOM records:

>d1n2ub1 d.113.1.2 (B:4-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk

Timeline for d1n2ub1:

• d1n2ub1 first appeared in SCOPe 2.06
  
• d1n2ub1 appears in SCOPe 2.07